PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo25G0008400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 269aa    MW: 29185.2 Da    PI: 7.3188
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo25G0008400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.3e-161558145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +g+WT eEd+ l ++v++ G  +W +I+r ++ gR++k+c++rw 
  Spipo25G0008400 15 KGPWTSEEDDALRRLVQEKGACNWPLISRSIP-GRSGKSCRLRWG 58
                     79******************************.***********5 PP

2Myb_DNA-binding33.88.1e-1169108344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++++eEde +++a +++G + W+ Ia  +  gRt++ +k +w
  Spipo25G0008400  69 PFSAEEDEAILHARARFGDE-WAVIALLLS-GRTGNAVKKHW 108
                      79****************99.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.7621265IPR017930Myb domain
SuperFamilySSF466895.14E-2513108IPR009057Homeodomain-like
SMARTSM007175.4E-131463IPR001005SANT/Myb domain
PfamPF002491.0E-141559IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-201670IPR009057Homeodomain-like
CDDcd001675.44E-141761No hitNo description
SMARTSM007171.1E-966114IPR001005SANT/Myb domain
PROSITE profilePS5129412.22667116IPR017930Myb domain
CDDcd001672.95E-869108No hitNo description
PfamPF002494.9E-969108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-1371116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAFGSMGDGC LERVKGPWTS EEDDALRRLV QEKGACNWPL ISRSIPGRSG KSCRLRWGNR  60
LSAQAEGRPF SAEEDEAILH ARARFGDEWA VIALLLSGRT GNAVKKHWDL SLKRKLSNSA  120
ASYDDADGPL PKRLTAGPPT SDVSNCRHHS EIFPTPRGGA GFIPPLVDLS SSIEAGGEKM  180
SCPATTLSLS PPGSNPCAIY GCCLRQRHLE ELPCENGDPA LGGNVAKLFP CLVFRDEEPR  240
QQSPLGAELR ALVQELIRKE VRNYILEL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-28121161105MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.19e-54myb domain protein 73